быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
NME1/NM23A Rabbit mAb (A8802)
- Описание
- Характеристики
-
Overview
Product name NME1/NM23A Rabbit mAb Catalog No. A8802 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1309 Background
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NME1/NME1/NM23A (P15531). Sequence MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK Gene ID Swiss Prot Synonyms NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1 Calculated MW 17kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, C6, Rat lung, Rat brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using NME1/NME1/NM23A Rabbit mAb (A8802) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NME1/NME1/NM23A (P15531). Isotype IgG







