быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TBK1/NAK Rabbit mAb (A3458)
- Описание
- Характеристики
-
Overview
Product name TBK1/NAK Rabbit mAb Catalog No. A3458 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0778 Background
The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. The protein is also an important kinase for antiviral innate immunity response.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2). Sequence MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE Gene ID Swiss Prot Synonyms NAK; T2K; IIAE8; FTDALS4 Calculated MW 84kDa Observed MW 84kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T, Hep G2, Mouse lung, Mouse testis, Rat testis Cellular location Cytoplasm Customer validation (RPMI-8226、A549、PC-3、HepG2、HL-60、Hela、U2-OS、Jurkat)
WB(Homo sapiens, Gallus gallus, Mus musculus )
Western blot analysis of extracts of various cell lines, using TBK1/NAK Rabbit mAb (A3458) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using TBK1/NAK Rabbit mAb (A3458) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Confocal imaging of MCF7 cells using TBK1/NAK Rabbit mAb (A3458, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using TBK1/NAK Rabbit mAb (A3458, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts from 293T cells using 3 μg TBK1/NAK Rabbit mAb (A3458). Western blot was performed from the immunoprecipitate using TBK1/NAK Rabbit mAb (A3458) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2). Isotype IgG