быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MYL2 Rabbit mAb (A8742)
- Описание
- Характеристики
-
Overview
Product name MYL2 Rabbit mAb Catalog No. A8742 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1286 Background
This gene encodes a major sarcomeric protein in mammalian striated muscle. The encoded protein plays a role in embryonic heart muscle structure and function, while phosphorylation of the encoded protein is involved in cardiac myosin cycling kinetics, torsion and function in adults. Mutations in this gene are associated with hypertrophic cardiomyopathy 10 and infant-onset myopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 67-166 of human MYL2 (P10916). Sequence DEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Gene ID Swiss Prot Synonyms MLC2; CMH10; MFM12; MLC-2; MLC-2v; MLC-2s/v Calculated MW 19kDa Observed MW 19kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse heart, Rat skeletal muscle, Rat heart Cellular location A band, Cytoplasm, Myofibril, Sarcomere 
Western blot analysis of extracts of various cell lines, using MYL2 Rabbit mAb (A8742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of rat heart using MYL2 Rabbit mAb (A8742) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse heart using MYL2 Rabbit mAb (A8742) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 67-166 of human MYL2 (P10916). Isotype IgG