быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Cyclophilin B Rabbit mAb (A4861)
- Описание
- Характеристики
-
Overview
Product name Cyclophilin B Rabbit mAb Catalog No. A4861 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0290 Background
The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclophilin B (P23284). Sequence FMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA Gene ID Swiss Prot Synonyms OI9; CYPB; SCYLP; CYP-S1; HEL-S-39 Calculated MW 24kDa Observed MW 19kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HT-29, HepG2, Mouse liver, Mouse kidney, Mouse pancreas, Rat lung, Rat liver, Rat spleen Cellular location Endoplasmic reticulum lumen, Melanosome 
Western blot analysis of extracts of various cell lines, using Cyclophilin B Rabbit mAb (A4861) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclophilin B (P23284). Isotype IgG