быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Rad50 Rabbit mAb (A3869)
- Описание
- Характеристики
-
Overview
Product name Rad50 Rabbit mAb Catalog No. A3869 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0854 Background
The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Rad50, a protein involved in DNA double-strand break repair. This protein forms a complex with MRE11 and NBS1. The protein complex binds to DNA and displays numerous enzymatic activities that are required for nonhomologous joining of DNA ends. This protein, cooperating with its partners, is important for DNA double-strand break repair, cell cycle checkpoint activation, telomere maintenance, and meiotic recombination. Knockout studies of the mouse homolog suggest this gene is essential for cell growth and viability. Mutations in this gene are the cause of Nijmegen breakage syndrome-like disorder.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Rad50 (Q92878). Sequence RCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQRNFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIV Gene ID Swiss Prot Synonyms NBSLD; RAD502; hRad50 Calculated MW 154kDa Observed MW 154kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, K-562, U-87MG, Mouse testis, Rat testis Cellular location Chromosome, Nucleus, telomere 
Western blot analysis of extracts of various cell lines, using Rad50 Rabbit mAb (A3869) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Rad50 (Q92878). Isotype IgG