быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ARF1 Rabbit mAb (A9195)
- Описание
- Характеристики
-
Overview
Product name ARF1 Rabbit mAb Catalog No. A9195 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1472 Background
ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077). Sequence GQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH Gene ID Swiss Prot Synonyms PVNH8 Calculated MW 21kDa Observed MW 19kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, HepG2, Mouse lung, Mouse spleen, Rat lung Cellular location Cell junction, Cytoplasm, Golgi apparatus, Lipid-anchor, Membrane, perinuclear region, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome 
Western blot analysis of extracts of various cell lines, using ARF1 Rabbit mAb (A9195) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of NIH-3T3 cells using ARF1 Rabbit mAb (A9195) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077). Isotype IgG