быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Epac1/RAPGEF3 Rabbit mAb (A4149)
- Описание
- Характеристики
-
Overview
Product name Epac1/RAPGEF3 Rabbit mAb Catalog No. A4149 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0908 Background
Enables guanyl-nucleotide exchange factor activity and protein domain specific binding activity. Involved in several processes, including positive regulation of protein modification processImmunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398). Sequence FIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP Gene ID Swiss Prot Synonyms EPAC Calculated MW 104kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse lung, Mouse brain, Mouse kidney, Rat brain Cellular location Endomembrane system 
Western blot analysis of extracts of various cell lines, using Epac1/RAPGEF3 Rabbit mAb (A4149) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human placenta using Epac1/RAPGEF3 Rabbit mAb (A4149) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398). Isotype IgG