быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
eIF5A Rabbit mAb (A4414)
- Описание
- Характеристики
-
Overview
Product name eIF5A Rabbit mAb Catalog No. A4414 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0999 Background
Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241). Sequence MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLS Gene ID Swiss Prot Synonyms FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI Calculated MW 17kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Jurkat, HUVEC, Mouse testis, Mouse pancreas, Rat lung, Rat testis, Rat spleen Cellular location Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, Nuclear pore complex 
Western blot analysis of extracts of various cell lines, using eIF5A Rabbit mAb (A4414) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241). Isotype IgG