быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Caveolin-2 Rabbit mAb (A4890)
- Описание
- Характеристики
-
Overview
Product name Caveolin-2 Rabbit mAb Catalog No. A4890 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0323 Background
The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caveolin-2 (P51636). Sequence MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIA Gene ID Swiss Prot Synonyms CAV Calculated MW 18kDa Observed MW 21kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, 293T, Mouse lung Cellular location Cell membrane, Cytoplasm, Golgi apparatus membrane, Membrane, Nucleus, Peripheral membrane protein, Caveola 
Western blot analysis of extracts of Mouse lung, using Caveolin-2 Rabbit mAb (A4890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of 293T cells, using Caveolin-2 Rabbit mAb (A4890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Caveolin-2 Rabbit mAb (A4890) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Caveolin-2 antibody (A4890). Western blot was performed from the immunoprecipitate using Caveolin-2 antibody (A4890) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caveolin-2 (P51636). Isotype IgG