быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
GLO1 Rabbit mAb (A4329)
- Описание
- Характеристики
-
Overview
Product name GLO1 Rabbit mAb Catalog No. A4329 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0969 Background
The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLO1 (Q04760). Sequence MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE Gene ID Swiss Prot Synonyms GLYI; GLOD1; HEL-S-74 Calculated MW 21kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, Mouse brain, Mouse kidney, Rat lung, Rat brain Cellular location cytoplasm, cytosol, extracellular exosome, nucleoplasm, plasma membrane 
Western blot analysis of extracts of various cell lines, using GLO1 Rabbit mAb (A4329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLO1 (Q04760). Isotype IgG