быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
KDM4A Rabbit mAb (A9267)
- Описание
- Характеристики
-
Overview
Product name KDM4A Rabbit mAb Catalog No. A9267 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1503 Background
This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-650 of human KDM4A (O75164). Sequence GDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPN Gene ID Swiss Prot Synonyms JMJD2; JHDM3A; JMJD2A; TDRD14A Calculated MW 121kDa Observed MW 150kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, NIH/3T3, SH-SY5Y Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using KDM4A Rabbit mAb (A9267) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-650 of human KDM4A (O75164). Isotype IgG