быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Pannexin 1 Rabbit mAb (A5167)
- Описание
- Характеристики
-
Overview
Product name Pannexin 1 Rabbit mAb Catalog No. A5167 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1207 Background
The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin 1 (Q96RD7). Sequence DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC Gene ID Swiss Prot Synonyms PX1; MRS1; OOMD7; OZEMA7; UNQ2529 Calculated MW 48kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples C2C12, K-562, U-87 MG, Mouse brain, Rat brain Cellular location Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Multi-pass membrane protein, gap junction 
Western blot analysis of extracts of various cell lines, using Pannexin 1 Rabbit mAb (A5167) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Pannexin 1 Rabbit mAb (A5167) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin 1 (Q96RD7). Isotype IgG