быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Profilin1 Rabbit mAb (A9188)
- Описание
- Характеристики
-
Overview
Product name Profilin1 Rabbit mAb Catalog No. A9188 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1469 Background
This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737). Sequence VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Gene ID Swiss Prot Synonyms ALS18 Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, NIH/3T3, C6, U-251MG, Mouse brain, Mouse thymus, Rat kidney Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using Profilin1 Rabbit mAb (A9188) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737). Isotype IgG