быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
CLEC3B/Tetranectin Rabbit mAb (A4387)
- Описание
- Характеристики
-
Overview
Product name CLEC3B/Tetranectin Rabbit mAb Catalog No. A4387 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0993 Background
Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 103-202 of human CLEC3B/Tetranectin (P05452). Sequence GTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Gene ID Swiss Prot Synonyms TN; TNA; MCDR4 Calculated MW 21kDa Observed MW 23-25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Human plasma, Mouse lung, Rat lung Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of C6 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 103-202 of human CLEC3B/Tetranectin (P05452). Isotype IgG