быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MMP12 Rabbit mAb (A3713)
- Описание
- Характеристики
-
Overview
Product name MMP12 Rabbit mAb Catalog No. A3713 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0280 Background
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease degrades soluble and insoluble elastin. This gene may play a role in aneurysm formation and mutations in this gene are associated with lung function and chronic obstructive pulmonary disease (COPD). This gene is part of a cluster of MMP genes on chromosome 11.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human MMP12 (P39900). Sequence FGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC Gene ID Swiss Prot Synonyms ME; HME; MME; MMP-12 Calculated MW 54kDa Observed MW 45kDa/54kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, BxPC-3, Mouse lung, Mouse brain, Mouse spleen, Rat lung Cellular location Secreted, extracellular matrix, extracellular space 
Western blot analysis of extracts of various cell lines, using MMP12 pAb (A3713) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human MMP12 (P39900). Isotype IgG