быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Cytokeratin 16 (KRT16) Rabbit mAb (A8690)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 16 (KRT16) Rabbit mAb Catalog No. A8690 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1783 Background
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (KRT16) (P08779). Sequence MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGA Gene ID Swiss Prot Synonyms K16; PC1; CK16; K1CP; NEPPK; FNEPPK; KRT16A Calculated MW 51kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse large intestine Cellular location cytoskeleton, cytosol, extracellular exosome, nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of Mouse large intestine, using Cytokeratin 16 (KRT16) antibody (A8690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Cytokeratin 16 (KRT16) Rabbit mAb (A8690) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat skin using Cytokeratin 16 (KRT16) Rabbit mAb (A8690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. Perform microwaveantigen retrieval with 10mM Tris/EDTA buffer pH9.0 before commencing with IF staining protocol.
Immunofluorescence analysis of human skin using Cytokeratin 16 (KRT16) Rabbit mAb (A8690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. Perform microwaveantigen retrieval with 10mM Tris/EDTA buffer pH9.0 before commencing with IF staining protocol.
Immunofluorescence analysis of Mouse tail and ear using Cytokeratin 16 (KRT16) Rabbit mAb (A8690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. Perform microwaveantigen retrieval with 10mM Tris/EDTA buffer pH9.0 before commencing with IF staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (KRT16) (P08779). Isotype IgG