быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
p16-ARC/ARC16/ARPC5 Rabbit mAb (A4794)
- Описание
- Характеристики
-
Overview
Product name p16-ARC/ARC16/ARPC5 Rabbit mAb Catalog No. A4794 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0221 Background
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p16-ARC/ARC16/ARPC5 (O15511). Sequence MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDK Gene ID Swiss Prot Synonyms ARC16; p16-Arc; dJ127C7.3 Calculated MW 16kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Mouse brain, Mouse thymus, Rat brain, Rat thymus Cellular location Cell projection, Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using p16-ARC/ARC16/ARPC5 Rabbit mAb (A4794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p16-ARC/ARC16/ARPC5 (O15511). Isotype IgG