быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
alpha 1 Spectrin Rabbit mAb (A9597)
- Описание
- Характеристики
-
Overview
Product name alpha 1 Spectrin Rabbit mAb Catalog No. A9597 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1650 Background
This gene encodes a member of a family of molecular scaffold proteins that link the plasma membrane to the actin cytoskeleton and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms a component of the erythrocyte plasma membrane. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis-2, pyropoikilocytosis, and spherocytosis, type 3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549). Sequence LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG Gene ID Swiss Prot Synonyms EL2; HPP; HS3; SPH3; SPTA Calculated MW 280kDa Observed MW 280kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, Mouse lung, Rat heart Cellular location Cytoplasm, cell cortex, cytoskeleton 
Western blot analysis of extracts of various cell lines, using alpha 1 Spectrin Rabbit mAb (A9597) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549). Isotype IgG