быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
FOXL2 Rabbit mAb (A3597)
- Описание
- Характеристики
-
Overview
Product name FOXL2 Rabbit mAb Catalog No. A3597 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2055 Background
This gene encodes a forkhead transcription factor. The protein contains a fork-head DNA-binding domain and may play a role in ovarian development and function. Expansion of a polyalanine repeat region and other mutations in this gene are a cause of blepharophimosis syndrome and premature ovarian failure 3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXL2 (P58012). Sequence MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQN Gene ID Swiss Prot Synonyms BPES; PFRK; POF3; BPES1; PINTO Calculated MW 39kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, K-562, Mouse testis, Rat testis, Rat ovary Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using FOXL2 Rabbit mAb (A3597) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of various cell lines, using FOXL2 Rabbit mAb (A3597) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXL2 (P58012). Isotype IgG