быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
GCLC Rabbit mAb (A4499)
- Описание
- Характеристики
-
Overview
Product name GCLC Rabbit mAb Catalog No. A4499 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1065 Background
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 538-637 of human GCLC (P48506). Sequence LNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN Gene ID Swiss Prot Synonyms GCL; GCS; GLCL; GLCLC Calculated MW 73kDa Observed MW 73kDa Applications
Reactivity Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HepG2, Rat kidney Cellular location cytosol, glutamate-cysteine ligase complex, mitochondrion 
Western blot analysis of extracts of Rat kidney, using GCLC Rabbit mAb (A4499) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of various cell lines, using GCLC Rabbit mAb (A4499) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat kidney using GCLC Rabbit mAb (A4499) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 538-637 of human GCLC (P48506). Isotype IgG