быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
DDAH1 Rabbit mAb (A4591)
- Описание
- Характеристики
-
Overview
Product name DDAH1 Rabbit mAb Catalog No. A4591 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1043 Background
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 186-285 of human DDAH1 (O94760). Sequence IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS Gene ID Swiss Prot Synonyms DDAH; DDAHI; DDAH-1; HEL-S-16 Calculated MW 31kDa Observed MW 37kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, U-251MG, Rat kidney Cellular location cytosol, extracellular exosome 
Western blot analysis of extracts of various cell lines, using DDAH1 Rabbit mAb (A4591) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat kidney, using DDAH1 Rabbit mAb (A4591) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 186-285 of human DDAH1 (O94760). Isotype IgG