быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
HP1 alpha/CBX5 Rabbit mAb (A3741)
- Описание
- Характеристики
-
Overview
Product name HP1 alpha/CBX5 Rabbit mAb Catalog No. A3741 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0244 Background
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973). Sequence SNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS Gene ID Swiss Prot Synonyms HP1; HP1A; HEL25 Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, 293T, MCF7, Mouse lung, Mouse brain, Rat lung, Rat brain Cellular location Chromosome, Nucleus, centromere 
Western blot analysis of extracts of various cell lines, using HP1 alpha/CBX5Rabbit mAb (A3741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using HP1 alpha/CBX5Rabbit mAb (A3741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat testis using HP1 alpha/CBX5Rabbit mAb (A3741) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using HP1 alpha/CBX5Rabbit mAb (A3741) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using HP1 alpha/CBX5Rabbit mAb (A3741) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg HP1 alpha/CBX5 antibody (A3741). Western blot was performed from the immunoprecipitate using HP1 alpha/CBX5 antibody (A3741) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973). Isotype IgG