быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
RACK1 Rabbit mAb (A3808)
- Описание
- Характеристики
-
Overview
Product name RACK1 Rabbit mAb Catalog No. A3808 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0837 Background
Enables several functions, including cyclin binding activity; enzyme binding activity; and protein domain specific binding activity. Involved in several processes, including positive regulation of hydrolase activity; regulation of cellular protein metabolic process; and regulation of signal transduction. Located in several cellular components, including midbody; perinuclear region of cytoplasm; and phagocytic cup. Part of IRE1-RACK1-PP2A complex.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244). Sequence DLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW Gene ID Swiss Prot Synonyms H12.3; HLC-7; PIG21; GNB2L1; Gnb2-rs1 Calculated MW 35kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat brain, Rat spleen, Rat kidney, 293T, HepG2, Jurkat, Mouse brain, Mouse spleen, Mouse kidney Cellular location Cell membrane, Cell projection, Cytoplasm, Nucleus, Perikaryon, Peripheral membrane protein, cytoskeleton, dendrite, perinuclear region, phagocytic cup 
Western blot analysis of extracts of various cell lines, using RACK1 Rabbit mAb (A3808) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using RACK1 Rabbit mAb (A3808) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244). Isotype IgG