быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
HAPLN1 Rabbit mAb (A4815)
- Описание
- Характеристики
-
Overview
Product name HAPLN1 Rabbit mAb Catalog No. A4815 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0234 Background
Predicted to enable hyaluronic acid binding activity. Predicted to be an extracellular matrix structural constituent conferring compression resistance. Predicted to be involved in central nervous system development and skeletal system development. Colocalizes with collagen-containing extracellular matrix.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915). Sequence VFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN Gene ID Swiss Prot Synonyms CRT1; CRTL1 Calculated MW 40kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-2 OS, A549, SH-SY5Y, Mouse lung, Mouse brain, Rat brain Cellular location Secreted, extracellular matrix, extracellular space 
Western blot analysis of extracts of various cell lines, using HAPLN1 Rabbit mAb (A4815) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-354 of human HAPLN1 (P10915). Isotype IgG