быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
SMARCA5/SNF2H Rabbit mAb (A3539)
- Описание
- Характеристики
-
Overview
Product name SMARCA5/SNF2H Rabbit mAb Catalog No. A3539 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0795 Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264). Sequence RFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL Gene ID Swiss Prot Synonyms ISWI; SNF2H; hISWI; hSNF2H; WCRF135 Calculated MW 122kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse thymus, HeLa, K-562 Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (A3539) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse thymus, using SMARCA5/SMARCA5/SNF2H Rabbit mAb (A3539) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of C6 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (A3539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (A3539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using SMARCA5/SMARCA5/SNF2H Rabbit mAb (A3539) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264). Isotype IgG