быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Glycogen synthase 1 (GYS1) Rabbit mAb (A8912)
- Описание
- Характеристики
-
Overview
Product name Glycogen synthase 1 (GYS1) Rabbit mAb Catalog No. A8912 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1350 Background
The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1, 4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807). Sequence RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN Gene ID Swiss Prot Synonyms GSY; GYS Calculated MW 84kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, RD, Mouse brain, Rat heart Cellular location cytoplasm, cytosol 
Western blot analysis of extracts of various cell lines, using Glycogen synthase 1 (Glycogen synthase 1 (GYS1)) Rabbit mAb (A8912) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807). Isotype IgG