быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Inhibin beta A (INHBA) Rabbit mAb (A5232)
- Описание
- Характеристики
-
Overview
Product name Inhibin beta A (INHBA) Rabbit mAb Catalog No. A5232 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1177 Background
This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Inhibin beta A (INHBA) (P08476). Sequence MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGY Gene ID Swiss Prot Synonyms EDF; FRP Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Mouse uterus, Rat testis Cellular location Secreted Customer validation WB(Mus musculus,Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using Inhibin beta A (INHBA) (INHBA) Rabbit mAb (A5232) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH-3T3 cells using Inhibin beta A (INHBA) (INHBA) Rabbit mAb (A5232) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Inhibin beta A (INHBA) (P08476). Isotype IgG