быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992)
- Описание
- Характеристики
-
Overview
Product name Myelin oligodendrocyte glycoprotein Rabbit mAb Catalog No. A3992 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0879 Background
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Myelin oligodendrocyte glycoprotein (NP_996532.2). Sequence MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTEL Gene ID Swiss Prot Synonyms BTN6; BTNL11; MOGIG2; NRCLP7 Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse brain, Rat brain Cellular location Cell membrane, Multi-pass membrane protein, Single-pass type I membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of rat brain using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse brain using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Myelin oligodendrocyte glycoprotein (NP_996532.2). Isotype IgG