быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TFPI Rabbit mAb (A8704)
- Описание
- Характеристики
-
Overview
Product name TFPI Rabbit mAb Catalog No. A8704 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1154 Background
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-304 of human TFPI (P10646). Sequence PQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM Gene ID Swiss Prot Synonyms EPI; TFI; LACI; TFPI1 Calculated MW 35kDa Observed MW 38kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3 Cellular location GPI-anchor, Lipid-anchor, Microsome membrane, Secreted 
Western blot analysis of extracts of BxPC-3 cells, using TFPI Rabbit mAb (A8704) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-304 of human TFPI (P10646). Isotype IgG







