быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Gelsolin Rabbit mAb (A2612)
- Описание
- Характеристики
-
Overview
Product name Gelsolin Rabbit mAb Catalog No. A2612 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1924 Background
The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Gelsolin (NP_000168.1). Sequence DQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ Gene ID Swiss Prot Synonyms ADF; AGEL Calculated MW 86kDa Observed MW 86kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples C2C12, Mouse lung, HeLa, A-549, RD Cellular location Cytoplasm, Secreted, cytoskeleton 
Western blot analysis of extracts of various cell lines, using Gelsolin Rabbit mAb (A2612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using Gelsolin Rabbit mAb (A2612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Gelsolin Rabbit mAb (A2612) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Gelsolin (NP_000168.1). Isotype IgG