быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ELMO1 Rabbit mAb (A5169)
- Описание
- Характеристики
-
Overview
Product name ELMO1 Rabbit mAb Catalog No. A5169 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1985 Background
This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 628-727 of human ELMO1 (Q92556). Sequence KGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN Gene ID Swiss Prot Synonyms CED12; CED-12; ELMO-1 Calculated MW 84kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Raji, SH-SY5Y, Mouse lung, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm 
Western blot analysis of extracts of various cell lines, using ELMO1 Rabbit mAb (A5169) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded rat spleen using ELMO1 Rabbit mAb (A5169) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using ELMO1 Rabbit mAb (A5169) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 628-727 of human ELMO1 (Q92556). Isotype IgG