![[One Step] NDUFS5 antibody Kit (RK05735)](/upload/resize_cache/iblock/121/340_340_140cd750bba9870f18aada2478b24840a/b2wqrasthd9mxcsime01ch5dhcr03c9v.jpg "[One Step] NDUFS5 antibody Kit (RK05735)")
быстрая доставка ~4 недели
Размер
- 50 μL
[One Step] NDUFS5 antibody Kit (RK05735)
- Описание
- Характеристики
-
Overview
Product name [One Step] NDUFS5 antibody Kit Catalog No. RK05735 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody NDUFS5 Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1). Sequence MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Gene ID 4725 Swiss prot O43920 Synonyms CI15K; CI-15k Applications
Calculated MW 13kDa Observed MW 13kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Mitochondrion,Mitochondrion inner membrane,Mitochondrion intermembrane space,Peripheral membrane protein 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).