![[One Step] MIF antibody Kit (RK05730)](/upload/resize_cache/iblock/3db/340_340_140cd750bba9870f18aada2478b24840a/i0afyu6xtb8dq6m0kx77s0xtb0jzm1ox.jpg "[One Step] MIF antibody Kit (RK05730)")
быстрая доставка ~4 недели
Размер
- 50 μL
[One Step] MIF antibody Kit (RK05730)
- Описание
- Характеристики
-
Overview
Product name [One Step] MIF antibody Kit Catalog No. RK05730 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody MIF Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1). Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Gene ID 4282 Swiss prot P14174 Synonyms GIF; GLIF; MMIF Applications
Calculated MW 12kDa Observed MW 12kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Cytoplasm,Secreted 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1).