быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]YWHAZ Antibody Kit (RK05724)
- Описание
- Характеристики
-
Overview
Product name [One Step]YWHAZ Antibody Kit Catalog No. RK05724 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody YWHAZ Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 190 to the C-terminus of human YWHAZ (NP_003397.1). Sequence SLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN Gene ID 7534 Swiss prot P63104 Synonyms HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta Applications
Calculated MW 28kDa Observed MW 28kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Cytoplasm,Melanosome 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 190 to the C-terminus of human YWHAZ (NP_003397.1).







