![[One Step]TOP1 Antibody Kit (RK05716)](/upload/resize_cache/iblock/eae/340_340_140cd750bba9870f18aada2478b24840a/bzqu2ybpqi57zdi571yjicq52zspozl2.jpg "[One Step]TOP1 Antibody Kit (RK05716)")
быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]TOP1 Antibody Kit (RK05716)
- Описание
- Характеристики
-
Overview
Product name [One Step]TOP1 Antibody Kit Catalog No. RK05716 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody DNA topoisomerase I (TOP1) Rabbit pAb 1:1000 dilution WB Human, Mouse Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:4000 dilution Background
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1). Sequence MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA Gene ID 7150 Swiss prot P11387 Synonyms TOPI Applications
Calculated MW 91kDa Observed MW 108kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Nucleus,nucleolus,nucleoplasm 
-
Antibody type Antibody Duos Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1).