быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]SRSF3 Antibody Kit (RK05710)
- Описание
- Характеристики
-
Overview
Product name [One Step]SRSF3 Antibody Kit Catalog No. RK05710 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody SRSF3 Rabbit pAb 1:2000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SRSF3 (NP_003008.1). Sequence MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNR Gene ID 6428 Swiss prot P84103 Synonyms SFRS3; SRp20 Applications
Calculated MW 19kDa Observed MW 22kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Cytoplasm,Nucleus 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SRSF3 (NP_003008.1).







