![[One Step]SLC7A5 Antibody Kit (RK05709)](/upload/resize_cache/iblock/224/340_340_140cd750bba9870f18aada2478b24840a/64a3k5dzi99fomqg00q1mir5clwt58fg.jpg "[One Step]SLC7A5 Antibody Kit (RK05709)")
быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]SLC7A5 Antibody Kit (RK05709)
- Описание
- Характеристики
-
Overview
Product name [One Step]SLC7A5 Antibody Kit Catalog No. RK05709 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody LAT1/SLC7A5 Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
Enables L-leucine transmembrane transporter activity; L-tryptophan transmembrane transporter activity; and thyroid hormone transmembrane transporter activity. Involved in carboxylic acid transport; thyroid hormone transport; and xenobiotic transport. Located in cytosol; intracellular membrane-bounded organelle; and plasma membrane. Is integral component of membrane. Part of amino acid transport complex; apical plasma membrane; and microvillus membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4). Sequence MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG Gene ID 8140 Swiss prot Q01650 Synonyms E16; CD98; LAT1; 4F2LC; MPE16; D16S469E Applications
Calculated MW 55kDa Observed MW 39kDa/50kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Apical cell membrane,Cytoplasm,Multi-pass membrane protein,cytosol 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LAT1/SLC7A5 (NP_003477.4).