![[One Step]SFPQ Antibody Kit (RK05708)](/upload/resize_cache/iblock/f9d/340_340_140cd750bba9870f18aada2478b24840a/b9l3j32al7775yln2emo6sbg6ha2nvff.jpg "[One Step]SFPQ Antibody Kit (RK05708)")
быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]SFPQ Antibody Kit (RK05708)
- Описание
- Характеристики
-
Overview
Product name [One Step]SFPQ Antibody Kit Catalog No. RK05708 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody SFPQ Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:4000 dilution Background
Enables DNA binding activity; histone deacetylase binding activity; and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome; positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway; and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin; nuclear matrix; and paraspeckles.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 578-707 of human SFPQ (NP_005057.1). Sequence MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF Gene ID 6421 Swiss prot P23246 Synonyms PSF; POMP100; PPP1R140 Applications
Calculated MW 76kDa Observed MW 115kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Cytoplasm,Nucleus matrix 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 578-707 of human SFPQ (NP_005057.1).