быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]COX5B Antibody Kit (RK05637)
- Описание
- Характеристики
-
Overview
Product name [One Step]COX5B Antibody Kit Catalog No. RK05637 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody COX5B Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-129 of human COX5B (NP_001853.2). Sequence ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH Gene ID 1329 Swiss prot P10606 Synonyms COXVB Applications
Calculated MW 14kDa Observed MW 14kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Mitochondrion inner membrane 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-129 of human COX5B (NP_001853.2).







