быстрая доставка ~4 недели
Размер
- 50 μL
[One Step]BMP5 Antibody Kit (RK05627)
- Описание
- Характеристики
-
Overview
Product name [One Step]BMP5 Antibody Kit Catalog No. RK05627 Product Component
Component Name Recommended Dilution Applications Species Reactivity Primary Antibody BMP5 Rabbit pAb 1:1000 dilution WB Human, Mouse, Rat Secondary Antibody HRP Goat Anti-Rabbit IgG (H+L) 1:10000 dilution Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1). Sequence AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH Gene ID 653 Swiss prot P22003 Synonyms BMP5 Applications
Calculated MW 52kDa Observed MW 52kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Cellular location Secreted 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1).







