быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-NDRG1-S330 Antibody kit (RK05769)
- Описание
- Характеристики
-
Overview
Product name Phospho-NDRG1-S330 Antibody kit Catalog No. RK05769 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-NDRG1-S330 Rabbit pAb AP0807 WB Human, Mouse [KO Validated] NDRG1 Rabbit pAb A2142 WB IF/ICC Human, Mouse, Rat Background
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 175-394 of human NDRG1 (NP_001128714.1).
A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1).Sequence WAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
TASGSGene ID 10397 Swiss prot Q92597 Synonyms GC4; RTP; DRG1; NDR1; NMSL; TDD5; CAP43; CMT4D; DRG-1; HMSNL; RIT42; TARG1; PROXY1 Applications
Calculated MW 43kDa Observed MW 50kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Cell membrane,Cytoplasm,Nucleus,centrosome,cytoskeleton,cytosol,microtubule organizing center 




-
Antibody type Antibody Duos Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 175-394 of human NDRG1 (NP_001128714.1).A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1).







