быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-EGFR-Y1045 Antibody kit (RK04080)
- Описание
- Характеристики
-
Overview
Product name Phospho-EGFR-Y1045 Antibody kit Catalog No. RK04080 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-EGFR-Y1045 Rabbit pAb AP0819 WB Human EGFR Rabbit pAb A11351 WB IHC-P IF/ICC IP Human, Mouse, Rat Background
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).
A synthetic phosphorylated peptide around Y1045 of human EGFR (NP_005219.2).Sequence QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
QRYSSGene ID 1956 Swiss prot P00533 Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2 Applications
Calculated MW 134kDa Observed MW 180kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Cell membrane,Endoplasmic reticulum membrane,Endosome,Endosome membrane,Golgi apparatus membrane,Nucleus membrane,Nucleus,Secreted,Single-pass type I membrane protein 
-
Antibody type Antibody Duos Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).A synthetic phosphorylated peptide around Y1045 of human EGFR (NP_005219.2).