быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-PPP1R12A-S507 Antibody kit (RK04097)
- Описание
- Характеристики
-
Overview
Product name Phospho-PPP1R12A-S507 Antibody kit Catalog No. RK04097 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-PPP1R12A-S507 Rabbit pAb AP0769 WB Human PPP1R12A Rabbit pAb A0587 WB IF/ICC IP Human, Mouse, Rat Background
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1).
A synthetic phosphorylated peptide around S507 of human PPP1R12A (NP_001137357.1).Sequence MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG
LASTSGene ID 4659 Swiss prot O14974 Synonyms MBS; GUBS; M130; MYPT1 Applications
Calculated MW 115kDa Observed MW 135kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Cytoplasm 






-
Antibody type Antibody Duos Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1).A synthetic phosphorylated peptide around S507 of human PPP1R12A (NP_001137357.1).







