быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-PPP1CA-T320 Antibody kit (RK04085)
- Описание
- Характеристики
-
Overview
Product name Phospho-PPP1CA-T320 Antibody kit Catalog No. RK04085 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-PPP1CA-T320 Rabbit pAb AP0786 WB IHC-P Human, Mouse, Rat PPP1CA Rabbit pAb A12468 WB IF/ICC Human, Mouse, Rat Background
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). This broadly expressed gene encodes the alpha subunit of the PP1 complex that associates with over 200 regulatory proteins to form holoenzymes which dephosphorylate their biological targets with high specificity. PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies suggest that PP1 is an important regulator of cardiac function and that PP1 deregulation is implicated in diabetes and multiple types of cancer. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).
A synthetic phosphorylated peptide around T320 of human PPP1CA (NP_002699.1).Sequence MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
PITPPGene ID 5499 Swiss prot P62136 Synonyms PP1A; PP-1A; PPP1A; PP1alpha Applications
Calculated MW 38kDa Observed MW 38kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Cytoplasm,Nucleus,nucleolus,nucleoplasm 




-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).A synthetic phosphorylated peptide around T320 of human PPP1CA (NP_002699.1).







