быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-CBX3-S83 Antibody kit (RK05782)
- Описание
- Характеристики
-
Overview
Product name Phospho-CBX3-S83 Antibody kit Catalog No. RK05782 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-HP1 gamma/CBX3-S83 Rabbit pAb AP0801 WB Human, Mouse [KO Validated] HP1 gamma/CBX3 Rabbit pAb A2248 WB IHC-P IF/ICC IP Human, Mouse, Rat Background
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2).
A synthetic phosphorylated peptide around S83 of human HP1 gamma/CBX3 (NP_009207.2).Sequence MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
RKSLSGene ID 11335 Swiss prot Q13185 Synonyms HECH; HP1-GAMMA; HP1Hs-gamma Applications
Calculated MW 21kDa Observed MW 22kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Nucleus 






-
Antibody type Antibody Duos Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2).A synthetic phosphorylated peptide around S83 of human HP1 gamma/CBX3 (NP_009207.2).







