быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-Histone H3-T3 Antibody kit (RK05771)
- Описание
- Характеристики
-
Overview
Product name Phospho-Histone H3-T3 Antibody kit Catalog No. RK05771 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-Histone H3-T3 Rabbit pAb AP0846 WB Human, Mouse, Rat, Other (Wide Range) Histone H3 Rabbit pAb A2348 WB IHC-P IF/ICC IP ChIP Human, Mouse, Rat, Other (Wide Range) Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 36-136 of human HIST3H3 (NP_003484.1).
A synthetic phosphorylated peptide around T3 of human HIST1H3A (NP_003520.1).Sequence VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
MARTKGene ID 8290/8350 Swiss prot Q16695/P68431 Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A Applications
Calculated MW 15kDa Observed MW 17kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Chromosome,Nucleus 











-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic peptide corresponding to a sequence within amino acids 36-136 of human HIST3H3 (NP_003484.1).A synthetic phosphorylated peptide around T3 of human HIST1H3A (NP_003520.1).







