быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-Histone H4-S1 Antibody kit (RK05612)
- Описание
- Характеристики
-
Overview
Product name Phospho-Histone H4-S1 Antibody kit Catalog No. RK05612 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-Histone H4-S1 Rabbit pAb AP0901 WB Human, Mouse, Rat, Other (Wide Range) Histone H4 Rabbit pAb A1131 WB Human, Mouse, Rat, Other (Wide Range) Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Histone H4 (NP_003529.1).
A synthetic phosphorylated peptide around S1 of human Histone H4 (NP_003529.1).Sequence RRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
MSGRGene ID 8359 Swiss prot P62805 Synonyms H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A Applications
Calculated MW 11kDa Observed MW 17kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location extracellular exosome,extracellular region,nucleoplasm,nucleus 

-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Histone H4 (NP_003529.1).A synthetic phosphorylated peptide around S1 of human Histone H4 (NP_003529.1).







