быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Phospho-MEK1-T292 Antibody kit (RK05808)
- Описание
- Характеристики
-
Overview
Product name Phospho-MEK1-T292 Antibody kit Catalog No. RK05808 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-MEK1-T292 Rabbit mAb AP1021 WB Human, Mouse, Rat [KO Validated] MEK1 Rabbit pAb A12687 WB IHC-P Human, Mouse, Rat Background
The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1).
A synthetic phosphorylated peptide around T292 of human Phospho-MEK1-T292 (Q02750).Sequence MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
PRTPGGene ID 5604 Swiss prot Q02750 Synonyms MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1 Applications
Calculated MW 43kDa Observed MW 45kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.Cellular location Cytoplasm,Membrane,Nucleus,Peripheral membrane protein,centrosome,cytoskeleton,microtubule organizing center,spindle pole body 
-
Antibody type Antibody Duos Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1).A synthetic phosphorylated peptide around T292 of human Phospho-MEK1-T292 (Q02750).