Артикул
RK06012
быстрая доставка ~4 недели
Наши менеджеры обязательно свяжутся с вами и уточнят условия заказа
Phospho-BCAR1-Y410 Antibody kit (RK06012)
- Описание
- Характеристики
-
Overview
Product name Phospho-BCAR1-Y410 Antibody kit Catalog No. RK06012 Product Component
Product name Catalog No. Positive Applications Species Reactivity Phospho-BCAR1-Y410 Rabbit pAb AP1058 WB Human, Mouse BCAR1 Rabbit pAb A18270 WB IHC-P IF/ICC Human, Mouse, Rat Background
The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded protein contains a Src-homology 3 (SH3) domain, a proline-rich domain, a substrate domain which contains 15 repeat of the YxxP consensus phosphorylation motif for Src family kinases, a serine-rich domain, and a bipartite Src-binding domain, which can bind both SH2 and SH3 domains. This adaptor protein functions in multiple cellular pathways, including in cell motility, apoptosis and cell cycle control. Dysregulation of this gene can have a wide range of effects, affecting different pathways, including cardiac development, vascular smooth muscle cells, liver and kidney function, endothelial migration, and cancer.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2).
A synthetic phosphorylated peptide around Y410 of human BCAR1 (NP_055382.2?).Sequence EPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATA
GVYAVGene ID 9564 Swiss prot P56945 Synonyms CAS; CAS1; CASS1; CRKAS; P130Cas Applications
Calculated MW 93kDa Observed MW 93kDa Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.Cellular location Cell junction,Cytoplasm,focal adhesion 




-
Antibody type Antibody Duos Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2).A synthetic phosphorylated peptide around Y410 of human BCAR1 (NP_055382.2?).







