быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Acetyl-Histone H3-K9 Rabbit mAb (A21107)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H3-K9 Rabbit mAb Catalog No. A21107 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50576 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic acetylated peptide around K9 of human Histone H3 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC IP ChIP DB CUT&Tag Recommended dilution - DB 1:500 - 1:1000
- WB 1:500 - 1:1000
- IHC-P 1:100 - 1:500
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
- ChIP 1:50 - 1:200
- CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, NIH3T3, C6 Cellular location Chromosome, Nucleus Customer validation WB(Homo sapiens)
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg Acetyl-Histone H3-K9 Rabbit mAb antibody (A21107), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Acetyl-Histone H3-K9 in representative gene loci (RPL30), as shown in figure.
Western blot analysis of extracts of various cell lines, using Acetyl-Histone H3-K9 antibody (A21107) at1:1000 dilution.HeLa and NIH/3T3 and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K9 antibody (A21107) at 1:1000 dilution.
Immunohistochemistry of paraffin-embedded human colon carcinoma using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human spleen using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse brain using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse intestin using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse spleen using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse testis using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat brain using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa treated with TSA and HeLa cells using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of NIH/3T3 cells using 5 μg Acetyl-Histone H3-K9 antibody (A21107). Western blot was performed from the immunoprecipitate using Acetyl-Histone H3-K9 antibody (A21107) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K9 Rabbit mAb (A21107) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K9 of human Histone H3 (NP_003520.1). Isotype IgG